Lineage for d2ftra1 (2ftr A:4-106)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) 
dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
Family d.58.4.15: EthD-like [143272] (1 protein)
Pfam PF07110Protein Hypothetical protein BH0200 [143273] (1 species) Species Bacillus halodurans [TaxId:86665] [143274] (1 PDB entry)
Uniprot Q9KGB0 4-106
Domain d2ftra1: 2ftr A:4-106 [134077]
complexed with cl, gol, unl
Details for d2ftra1
PDB Entry: 2ftr (more details), 1.4 Å
PDB Description: Crystal structure of an ethyl tert-butyl ether d (ethd) family protein (bh0200) from bacillus halodurans c-125 at 1.40 A resolution
PDB Compounds: (A:) bh0200SCOPe Domain Sequences for d2ftra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ftra1 d.58.4.15 (A:4-106) Hypothetical protein BH0200 {Bacillus halodurans [TaxId: 86665]}
enmmvklialyeqpedkqafdehyfnthapltrkipglrdmkvtrivgspmgeskfylmc
emyyddheslqqamrtdegkasgkdamkfagklltlmigeemd
SCOPe Domain Coordinates for d2ftra1:
Click to download the PDB-style file with coordinates for d2ftra1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ftra1:
- d2ftra1 first appeared in SCOP 1.73
- d2ftra1 appears in SCOPe 2.07
View in 3D
