SCOP 1.73: Domain d2ftra1: 2ftr A:4-106

Lineage for d2ftra1 (2ftr A:4-106)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (17 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.15: EthD-like [143272] (1 protein)
   Pfam PF07110

6. Protein Hypothetical protein BH0200 [143273] (1 species)

7. Species Bacillus halodurans [TaxId:86665] [143274] (1 PDB entry)

8. Domain d2ftra1: 2ftr A:4-106 [134077]
   complexed with cl, gol, unl

Details for d2ftra1

PDB Entry: 2ftr, 1.4 Å

PDB Description: Crystal structure of an ethyl tert-butyl ether d (ethd) family protein (bh0200) from bacillus halodurans c-125 at 1.40 A resolution

PDB Compounds: (A:) bh0200

SCOP Domain Sequences for d2ftra1:

Sequence; same for both SEQRES and ATOM records:

>d2ftra1 d.58.4.15 (A:4-106) Hypothetical protein BH0200 {Bacillus halodurans [TaxId: 86665]}
enmmvklialyeqpedkqafdehyfnthapltrkipglrdmkvtrivgspmgeskfylmc
emyyddheslqqamrtdegkasgkdamkfagklltlmigeemd

Timeline for d2ftra1:

• d2ftra1 is new in SCOP 1.73
  
• d2ftra1 appears in SCOP 1.75
  
• d2ftra1 appears in the current release, SCOPe 2.08