SCOPe 2.08: Domain d2ftrb_: 2ftr B:

Lineage for d2ftrb_ (2ftr B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.15: EthD-like [143272] (1 protein)
   Pfam PF07110

6. Protein Hypothetical protein BH0200 [143273] (1 species)

7. Species Bacillus halodurans [TaxId:86665] [143274] (1 PDB entry)
   Uniprot Q9KGB0 4-106

8. Domain d2ftrb_: 2ftr B: [134078]
   automated match to d2ftra1
   complexed with cl, gol, unl

Details for d2ftrb_

PDB Entry: 2ftr, 1.4 Å

PDB Description: Crystal structure of an ethyl tert-butyl ether d (ethd) family protein (bh0200) from bacillus halodurans c-125 at 1.40 A resolution

PDB Compounds: (B:) bh0200

SCOPe Domain Sequences for d2ftrb_:

Sequence; same for both SEQRES and ATOM records:

>d2ftrb_ d.58.4.15 (B:) Hypothetical protein BH0200 {Bacillus halodurans [TaxId: 86665]}
mmvklialyeqpedkqafdehyfnthapltrkipglrdmkvtrivgspmgeskfylmcem
yyddheslqqamrtdegkasgkdamkfagklltlmigeem

Timeline for d2ftrb_:

• d2ftrb_ first appeared in SCOP 1.73, called d2ftrb1
  
• d2ftrb_ appears in SCOPe 2.07