PDB entry 2ftr

View 2ftr on RCSB PDB site
Description: Crystal structure of an ethyl tert-butyl ether d (ethd) family protein (bh0200) from bacillus halodurans c-125 at 1.40 A resolution
Class: unknown function
Keywords: Structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, unknown function
Deposited on 2006-01-24, released 2006-02-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.149
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bh0200
    Species: BACILLUS HALODURANS [TaxId:272558]
    Gene: 10172812
    Database cross-references and differences (RAF-indexed):
    • GB BAB03919
      • modified residue (6-7)
      • modified residue (44)
      • modified residue (54)
      • modified residue (62)
      • modified residue (65)
      • modified residue (77)
      • modified residue (90)
      • modified residue (100)
      • modified residue (105)
    Domains in SCOPe 2.08: d2ftra1
  • Chain 'B':
    Compound: bh0200
    Species: BACILLUS HALODURANS [TaxId:272558]
    Gene: 10172812
    Database cross-references and differences (RAF-indexed):
    • GB BAB03919
      • modified residue (6-7)
      • modified residue (44)
      • modified residue (54)
      • modified residue (62)
      • modified residue (65)
      • modified residue (77)
      • modified residue (90)
      • modified residue (100)
      • modified residue (105)
    Domains in SCOPe 2.08: d2ftrb_
  • Heterogens: CL, UNL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2ftrA (A:)
gmkgenmmvklialyeqpedkqafdehyfnthapltrkipglrdmkvtrivgspmgeskf
ylmcemyyddheslqqamrtdegkasgkdamkfagklltlmigeemde

    Sequence, based on observed residues (ATOM records): (download) 
    >2ftrA (A:)
enmmvklialyeqpedkqafdehyfnthapltrkipglrdmkvtrivgspmgeskfylmc
emyyddheslqqamrtdegkasgkdamkfagklltlmigeemd

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2ftrB (B:)
gmkgenmmvklialyeqpedkqafdehyfnthapltrkipglrdmkvtrivgspmgeskf
ylmcemyyddheslqqamrtdegkasgkdamkfagklltlmigeemde

    Sequence, based on observed residues (ATOM records): (download) 
    >2ftrB (B:)
mmvklialyeqpedkqafdehyfnthapltrkipglrdmkvtrivgspmgeskfylmcem
yyddheslqqamrtdegkasgkdamkfagklltlmigeem