Lineage for d2f8nd_ (2f8n D:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1482597Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1482598Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1482599Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1482695Protein Histone H2B [47119] (6 species)
  7. 1482785Species Mouse (Mus musculus), H2Ba [TaxId:10090] [140393] (2 PDB entries)
    Uniprot Q9D2U9 34-126
  8. 1482786Domain d2f8nd_: 2f8n D: [133135]
    Other proteins in same PDB: d2f8na_, d2f8nb_, d2f8ne_, d2f8nf_, d2f8ng_, d2f8nk1
    automated match to d1kx5d_
    protein/DNA complex

Details for d2f8nd_

PDB Entry: 2f8n (more details), 2.9 Å

PDB Description: 2.9 Angstrom X-ray structure of hybrid macroH2A nucleosomes
PDB Compounds: (D:) Histone 3, H2ba

SCOPe Domain Sequences for d2f8nd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f8nd_ a.22.1.1 (D:) Histone H2B {Mouse (Mus musculus), H2Ba [TaxId: 10090]}
rkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiaseasrlahynkrstitsr
evqtavrlllpgelakhavsegtkavtkytssk

SCOPe Domain Coordinates for d2f8nd_:

Click to download the PDB-style file with coordinates for d2f8nd_.
(The format of our PDB-style files is described here.)

Timeline for d2f8nd_: