SCOP 1.73: Domain d2f8nd1: 2f8n D:1230-1322

Lineage for d2f8nd1 (2f8n D:1230-1322)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (4 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H2B [47119] (5 species)

7. Species Mouse (Mus musculus), H2Ba [TaxId:10090] [140393] (2 PDB entries)

8. Domain d2f8nd1: 2f8n D:1230-1322 [133135]
   Other proteins in same PDB: d2f8na1, d2f8nb1, d2f8ne1, d2f8nf1, d2f8ng1
   automatically matched to 1U35 D:1230-1322

Details for d2f8nd1

PDB Entry: 2f8n, 2.9 Å

PDB Description: 2.9 Angstrom X-ray structure of hybrid macroH2A nucleosomes

PDB Compounds: (D:) Histone 3, H2ba

SCOP Domain Sequences for d2f8nd1:

Sequence; same for both SEQRES and ATOM records:

>d2f8nd1 a.22.1.1 (D:1230-1322) Histone H2B {Mouse (Mus musculus), H2Ba [TaxId: 10090]}
rkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiaseasrlahynkrstitsr
evqtavrlllpgelakhavsegtkavtkytssk

Timeline for d2f8nd1:

• d2f8nd1 is new in SCOP 1.73
  
• d2f8nd1 appears in SCOP 1.75
  
• d2f8nd1 appears in the current release, SCOPe 2.08, called d2f8nd_