Lineage for d2dtra1 (2dtr A:4-64)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693576Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins)
    automatically mapped to Pfam PF01325
  6. 2693577Protein Diphtheria toxin repressor (DtxR) [46883] (1 species)
  7. 2693578Species Corynebacterium diphtheriae [TaxId:1717] [46884] (20 PDB entries)
    Uniprot P33120
  8. 2693579Domain d2dtra1: 2dtr A:4-64 [16193]
    Other proteins in same PDB: d2dtra2, d2dtra3
    complexed with co, so4

Details for d2dtra1

PDB Entry: 2dtr (more details), 1.9 Å

PDB Description: structure of diphtheria toxin repressor
PDB Compounds: (A:) diphtheria toxin repressor

SCOPe Domain Sequences for d2dtra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dtra1 a.4.5.24 (A:4-64) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
lvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrslq
m

SCOPe Domain Coordinates for d2dtra1:

Click to download the PDB-style file with coordinates for d2dtra1.
(The format of our PDB-style files is described here.)

Timeline for d2dtra1: