SCOPe 2.08: Domain d2dtra3: 2dtr A:148-226

Lineage for d2dtra3 (2dtr A:148-226)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (4 families)
   the N-terminal domains of these repressors bind DNA

5. Family b.34.1.2: FeoA-like [50041] (5 proteins)

6. Protein Diphtheria toxin repressor (DtxR) [50042] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [50043] (18 PDB entries)
   Uniprot P33120

8. Domain d2dtra3: 2dtr A:148-226 [24450]
   Other proteins in same PDB: d2dtra1, d2dtra2
   complexed with co, so4

Details for d2dtra3

PDB Entry: 2dtr, 1.9 Å

PDB Description: structure of diphtheria toxin repressor

PDB Compounds: (A:) diphtheria toxin repressor

SCOPe Domain Sequences for d2dtra3:

Sequence, based on SEQRES records:

>d2dtra3 b.34.1.2 (A:148-226) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
pgtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrdghitlshn
gkdvellddlahtirieel

Sequence, based on observed residues (ATOM records):

>d2dtra3 b.34.1.2 (A:148-226) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
pgtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrhitlshngk
dvellddlahtirieel

Timeline for d2dtra3:

• d2dtra3 first appeared (with stable ids) in SCOP 1.55, called d2dtr_3
  
• d2dtra3 appears in SCOPe 2.07