SCOP 1.55: Domain d2dtr_3: 2dtr 148-226

Lineage for d2dtr_3 (2dtr 148-226)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.34: SH3-like barrel [50036] (7 superfamilies)

4. Superfamily b.34.1: C-terminal domain of biotin and diphtheria toxin repressors [50037] (2 families)

5. Family b.34.1.2: Diphtheria toxin repressor (DtxR) [50041] (1 protein)

6. Protein Diphtheria toxin repressor (DtxR) [50042] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [50043] (7 PDB entries)

8. Domain d2dtr_3: 2dtr 148-226 [24450]
   Other proteins in same PDB: d2dtr_1, d2dtr_2

Details for d2dtr_3

PDB Entry: 2dtr, 2 Å

PDB Description: structure of diphtheria toxin repressor

SCOP Domain Sequences for d2dtr_3:

Sequence, based on SEQRES records:

>d2dtr_3 b.34.1.2 (148-226) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
pgtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrdghitlshn
gkdvellddlahtirieel

Sequence, based on observed residues (ATOM records):

>d2dtr_3 b.34.1.2 (148-226) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
pgtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrhitlshngk
dvellddlahtirieel

Timeline for d2dtr_3:

• d2dtr_3 appears in SCOP 1.57
  
• d2dtr_3 appears in the current release, SCOPe 2.08, called d2dtra3