Lineage for d2dtr_3 (2dtr 148-226)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13047Fold b.34: SH3-like barrel [50036] (7 superfamilies)
  4. 13048Superfamily b.34.1: C-terminal domain of biotin and diphtheria toxin repressors [50037] (2 families) (S)
  5. 13054Family b.34.1.2: Diphtheria toxin repressor (DtxR) [50041] (1 protein)
  6. 13055Protein Diphtheria toxin repressor (DtxR) [50042] (1 species)
  7. 13056Species Corynebacterium diphtheriae [TaxId:1717] [50043] (7 PDB entries)
  8. 13058Domain d2dtr_3: 2dtr 148-226 [24450]
    Other proteins in same PDB: d2dtr_1, d2dtr_2

Details for d2dtr_3

PDB Entry: 2dtr (more details), 2 Å

PDB Description: structure of diphtheria toxin repressor

SCOP Domain Sequences for d2dtr_3:

Sequence, based on SEQRES records: (download)

>d2dtr_3 b.34.1.2 (148-226) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
pgtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrdghitlshn
gkdvellddlahtirieel

Sequence, based on observed residues (ATOM records): (download)

>d2dtr_3 b.34.1.2 (148-226) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
pgtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrhitlshngk
dvellddlahtirieel

SCOP Domain Coordinates for d2dtr_3:

Click to download the PDB-style file with coordinates for d2dtr_3.
(The format of our PDB-style files is described here.)

Timeline for d2dtr_3: