Lineage for d2bj9a2 (2bj9 A:51-134)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954059Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 2954103Family d.58.18.4: Nickel responsive regulator NikR, C-terminal domain [102999] (2 proteins)
    automatically mapped to Pfam PF08753
  6. 2954145Protein automated matches [254488] (1 species)
    not a true protein
  7. 2954146Species Pyrococcus horikoshii OT3 [TaxId:70601] [255055] (2 PDB entries)
  8. 2954147Domain d2bj9a2: 2bj9 A:51-134 [128617]
    Other proteins in same PDB: d2bj9a1, d2bj9b1
    automated match to d2bj9a2
    complexed with ni, pg4, po4

Details for d2bj9a2

PDB Entry: 2bj9 (more details), 3 Å

PDB Description: nikr with bound nickel and phosphate
PDB Compounds: (A:) nickel responsive regulator

SCOPe Domain Sequences for d2bj9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bj9a2 d.58.18.4 (A:51-134) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
neevagtitivynhdegdvvkalldlqheyldeiisslhvhmdehnclevivvkgeakki
kmiadkllslkgvkhgklvmtstg

SCOPe Domain Coordinates for d2bj9a2:

Click to download the PDB-style file with coordinates for d2bj9a2.
(The format of our PDB-style files is described here.)

Timeline for d2bj9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bj9a1