Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.18: ACT-like [55021] (15 families) regulatory domain linked to a wide range of metabolic enzymes |
Family d.58.18.4: Nickel responsive regulator NikR, C-terminal domain [102999] (2 proteins) automatically mapped to Pfam PF08753 |
Protein automated matches [254488] (1 species) not a true protein |
Species Pyrococcus horikoshii OT3 [TaxId:70601] [255055] (2 PDB entries) |
Domain d2bj9a2: 2bj9 A:51-134 [128617] Other proteins in same PDB: d2bj9a1, d2bj9b1 automated match to d2bj9a2 complexed with ni, pg4, po4 |
PDB Entry: 2bj9 (more details), 3 Å
SCOPe Domain Sequences for d2bj9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bj9a2 d.58.18.4 (A:51-134) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]} neevagtitivynhdegdvvkalldlqheyldeiisslhvhmdehnclevivvkgeakki kmiadkllslkgvkhgklvmtstg
Timeline for d2bj9a2: