SCOPe 2.08: Domain d2bj9a1: 2bj9 A:1-50

Lineage for d2bj9a1 (2bj9 A:1-50)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families)
   formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon

5. Family a.43.1.0: automated matches [230594] (1 protein)
   not a true family

6. Protein automated matches [230595] (4 species)
   not a true protein

7. Species Pyrococcus horikoshii OT3 [TaxId:70601] [255054] (2 PDB entries)

8. Domain d2bj9a1: 2bj9 A:1-50 [128616]
   Other proteins in same PDB: d2bj9a2, d2bj9b2
   automated match to d2bj7a1
   complexed with ni, pg4, po4

Details for d2bj9a1

PDB Entry: 2bj9, 3 Å

PDB Description: nikr with bound nickel and phosphate

PDB Compounds: (A:) nickel responsive regulator

SCOPe Domain Sequences for d2bj9a1:

Sequence; same for both SEQRES and ATOM records:

>d2bj9a1 a.43.1.0 (A:1-50) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
melirfsisipskllekfdqiieeigyenrseairdlirdfiirhewevg

Timeline for d2bj9a1:

• d2bj9a1 first appeared in SCOP 1.73
  
• d2bj9a1 appears in SCOPe 2.07