SCOPe 2.08: Domain d2bj9b2: 2bj9 B:51-138

Lineage for d2bj9b2 (2bj9 B:51-138)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.18: ACT-like [55021] (15 families)
   regulatory domain linked to a wide range of metabolic enzymes

5. Family d.58.18.4: Nickel responsive regulator NikR, C-terminal domain [102999] (2 proteins)
   automatically mapped to Pfam PF08753

6. Protein automated matches [254488] (1 species)
   not a true protein

7. Species Pyrococcus horikoshii OT3 [TaxId:70601] [255055] (2 PDB entries)

8. Domain d2bj9b2: 2bj9 B:51-138 [128619]
   Other proteins in same PDB: d2bj9a1, d2bj9b1
   automated match to d2bj9b2
   complexed with ni, pg4, po4

Details for d2bj9b2

PDB Entry: 2bj9, 3 Å

PDB Description: nikr with bound nickel and phosphate

PDB Compounds: (B:) nickel responsive regulator

SCOPe Domain Sequences for d2bj9b2:

Sequence; same for both SEQRES and ATOM records:

>d2bj9b2 d.58.18.4 (B:51-138) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
neevagtitivynhdegdvvkalldlqheyldeiisslhvhmdehnclevivvkgeakki
kmiadkllslkgvkhgklvmtstgkelv

Timeline for d2bj9b2:

• d2bj9b2 first appeared in SCOP 1.73
  
• d2bj9b2 appears in SCOPe 2.07