Lineage for d2asya1 (2asy A:1-101)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. Family d.58.4.12: Hypothetical protein YdhR [117940] (2 proteins)
    automatically mapped to Pfam PF08803
  6. Protein Hypothetical protein YdhR [117941] (1 species)
  7. Species Escherichia coli [TaxId:562] [117942] (3 PDB entries)
    Uniprot P77225
  8. Domain d2asya1: 2asy A:1-101 [127278]

Details for d2asya1

PDB Entry: 2asy (more details)

PDB Description: Solution Structure of ydhR protein from Escherichia coli
PDB Compounds: (A:) Protein ydhR precursor

SCOPe Domain Sequences for d2asya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2asya1 d.58.4.12 (A:1-101) Hypothetical protein YdhR {Escherichia coli [TaxId: 562]}
matllqlhfafngpfgdamaeqlkplaesinqepgflwkvwteseknheaggiylftdek
salaylekhtarlknlgveevvakvfdvneplsqinqakla

SCOPe Domain Coordinates for d2asya1 are not available.

Timeline for d2asya1:

Domains from other chains:
(mouse over for more information)
d2asyb_