PDB entry 2asy

View 2asy on RCSB PDB site
Description: Solution Structure of ydhR protein from Escherichia coli
Class: structural genomics, unknown function
Keywords: dimeric apha+beta barrel, homodimer, Structural Genomics, Ontario Centre for Structural Proteomics, OCSP, UNKNOWN FUNCTION
Deposited on 2005-08-24, released 2005-11-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein ydhR precursor
    Species: Escherichia coli [TaxId:562]
    Gene: ydhR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2asya1
  • Chain 'B':
    Compound: Protein ydhR precursor
    Species: Escherichia coli [TaxId:562]
    Gene: ydhR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2asyb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2asyA (A:)
    mgtshhhhhhssgrenlyfqghmatllqlhfafngpfgdamaeqlkplaesinqepgflw
    kvwteseknheaggiylftdeksalaylekhtarlknlgveevvakvfdvneplsqinqa
    kla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2asyA (A:)
    matllqlhfafngpfgdamaeqlkplaesinqepgflwkvwteseknheaggiylftdek
    salaylekhtarlknlgveevvakvfdvneplsqinqakla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2asyB (B:)
    mgtshhhhhhssgrenlyfqghmatllqlhfafngpfgdamaeqlkplaesinqepgflw
    kvwteseknheaggiylftdeksalaylekhtarlknlgveevvakvfdvneplsqinqa
    kla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2asyB (B:)
    matllqlhfafngpfgdamaeqlkplaesinqepgflwkvwteseknheaggiylftdek
    salaylekhtarlknlgveevvakvfdvneplsqinqakla