Lineage for d2asyb_ (2asy B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949708Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2949940Family d.58.4.12: Hypothetical protein YdhR [117940] (2 proteins)
    automatically mapped to Pfam PF08803
  6. 2949941Protein Hypothetical protein YdhR [117941] (1 species)
  7. 2949942Species Escherichia coli [TaxId:562] [117942] (3 PDB entries)
    Uniprot P77225
  8. 2949947Domain d2asyb_: 2asy B: [127279]
    automated match to d2asya1

Details for d2asyb_

PDB Entry: 2asy (more details)

PDB Description: solution structure of ydhr protein from escherichia coli
PDB Compounds: (B:) Protein ydhR precursor

SCOPe Domain Sequences for d2asyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2asyb_ d.58.4.12 (B:) Hypothetical protein YdhR {Escherichia coli [TaxId: 562]}
matllqlhfafngpfgdamaeqlkplaesinqepgflwkvwteseknheaggiylftdek
salaylekhtarlknlgveevvakvfdvneplsqinqakla

SCOPe Domain Coordinates for d2asyb_:

Click to download the PDB-style file with coordinates for d2asyb_.
(The format of our PDB-style files is described here.)

Timeline for d2asyb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2asya1