![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (17 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
![]() | Family d.58.4.12: Hypothetical protein YdhR [117940] (1 protein) |
![]() | Protein Hypothetical protein YdhR [117941] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [117942] (3 PDB entries) |
![]() | Domain d2asya1: 2asy A:1-101 [127278] |
PDB Entry: 2asy (more details)
SCOP Domain Sequences for d2asya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2asya1 d.58.4.12 (A:1-101) Hypothetical protein YdhR {Escherichia coli [TaxId: 562]} matllqlhfafngpfgdamaeqlkplaesinqepgflwkvwteseknheaggiylftdek salaylekhtarlknlgveevvakvfdvneplsqinqakla
Timeline for d2asya1: