Lineage for d2a35a1 (2a35 A:4-213)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842598Protein Hypothetical protein PA4017 [141911] (1 species)
    unknown function; the active site region is blocked by a loop; strong sequence similarity to mammalian TAT-interacting protein TIP30
  7. 2842599Species Pseudomonas aeruginosa [TaxId:287] [141912] (1 PDB entry)
    Uniprot Q9HX10 4-215
  8. 2842600Domain d2a35a1: 2a35 A:4-213 [126072]
    Other proteins in same PDB: d2a35a2, d2a35b3

Details for d2a35a1

PDB Entry: 2a35 (more details), 1.5 Å

PDB Description: 1.5 a crystal structure of a protein of unknown function pa4017 from pseudomonas aeruginosa pao1, possible epimerase
PDB Compounds: (A:) hypothetical protein PA4017

SCOPe Domain Sequences for d2a35a1:

Sequence, based on SEQRES records: (download)

>d2a35a1 c.2.1.2 (A:4-213) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]}
tpkrvllagatgltgehlldrilseptlakviaparkalaehprldnpvgplaellpqld
gsidtafcclgttikeagseeafravdfdlplavgkralemgarhylvvsalgadakssi
fynrvkgeleqalqeqgwpqltiarpsllfgpreefrlaeilaapiarilpgkyhgieac
dlaralwrlaleegkgvrfvesdelrklgk

Sequence, based on observed residues (ATOM records): (download)

>d2a35a1 c.2.1.2 (A:4-213) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]}
tpkrvllagatgltgehlldrilseptlakviaparkalaehprldnpvgplaellpqld
gsidtafcclgttikeagseeafravdfdlplavgkralemgarhylvvsalgadakssi
fynrvkgeleqalqeqgwpqltiarpsllfgpreefrlaeilaapiagkyhgieacdlar
alwrlaleegkgvrfvesdelrklgk

SCOPe Domain Coordinates for d2a35a1:

Click to download the PDB-style file with coordinates for d2a35a1.
(The format of our PDB-style files is described here.)

Timeline for d2a35a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2a35a2