PDB entry 2a35

View 2a35 on RCSB PDB site
Description: 1.5 A Crystal Structure of a Protein of Unknown Function PA4017 from Pseudomonas aeruginosa PAO1, Possible Epimerase
Class: structural genomics, unknown function
Keywords: Pseudomonas aeruginosa, alpha-beta-alpha sandwich, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2005-06-23, released 2005-08-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.176
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PA4017
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: gi:9950210
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HX10 (Start-212)
      • cloning artifact (213-214)
    Domains in SCOPe 2.07: d2a35a1, d2a35a2
  • Chain 'B':
    Compound: hypothetical protein PA4017
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: gi:9950210
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HX10 (Start-212)
      • cloning artifact (213-214)
    Domains in SCOPe 2.07: d2a35b2, d2a35b3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a35A (A:)
    mhstpkrvllagatgltgehlldrilseptlakviaparkalaehprldnpvgplaellp
    qldgsidtafcclgttikeagseeafravdfdlplavgkralemgarhylvvsalgadak
    ssifynrvkgeleqalqeqgwpqltiarpsllfgpreefrlaeilaapiarilpgkyhgi
    eacdlaralwrlaleegkgvrfvesdelrklgkgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a35A (A:)
    tpkrvllagatgltgehlldrilseptlakviaparkalaehprldnpvgplaellpqld
    gsidtafcclgttikeagseeafravdfdlplavgkralemgarhylvvsalgadakssi
    fynrvkgeleqalqeqgwpqltiarpsllfgpreefrlaeilaapiagkyhgieacdlar
    alwrlaleegkgvrfvesdelrklgkgs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a35B (B:)
    mhstpkrvllagatgltgehlldrilseptlakviaparkalaehprldnpvgplaellp
    qldgsidtafcclgttikeagseeafravdfdlplavgkralemgarhylvvsalgadak
    ssifynrvkgeleqalqeqgwpqltiarpsllfgpreefrlaeilaapiarilpgkyhgi
    eacdlaralwrlaleegkgvrfvesdelrklgkgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a35B (B:)
    tpkrvllagatgltgehlldrilseptlakviaparkalaehprldnpvgplaellpqld
    gsidtafcclgttikeagseeafravdfdlplavgkralemgarhylvvsalgadakssi
    fynrvkgeleqalqeqgwpqltiarpsllfgpreefrlaeilaapipgkyhgieacdlar
    alwrlaleegkgvrfvesdelrklgkgs