![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
![]() | Protein Hypothetical protein PA4017 [141911] (1 species) unknown function; the active site region is blocked by a loop; strong sequence similarity to mammalian TAT-interacting protein TIP30 |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [141912] (1 PDB entry) Uniprot Q9HX10 4-215 |
![]() | Domain d2a35b2: 2a35 B:4-213 [126073] Other proteins in same PDB: d2a35a2, d2a35b3 automated match to d2a35a1 |
PDB Entry: 2a35 (more details), 1.5 Å
SCOPe Domain Sequences for d2a35b2:
Sequence, based on SEQRES records: (download)
>d2a35b2 c.2.1.2 (B:4-213) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} tpkrvllagatgltgehlldrilseptlakviaparkalaehprldnpvgplaellpqld gsidtafcclgttikeagseeafravdfdlplavgkralemgarhylvvsalgadakssi fynrvkgeleqalqeqgwpqltiarpsllfgpreefrlaeilaapiarilpgkyhgieac dlaralwrlaleegkgvrfvesdelrklgk
>d2a35b2 c.2.1.2 (B:4-213) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} tpkrvllagatgltgehlldrilseptlakviaparkalaehprldnpvgplaellpqld gsidtafcclgttikeagseeafravdfdlplavgkralemgarhylvvsalgadakssi fynrvkgeleqalqeqgwpqltiarpsllfgpreefrlaeilaapipgkyhgieacdlar alwrlaleegkgvrfvesdelrklgk
Timeline for d2a35b2: