SCOPe 2.08: Domain d1zkea1: 1zke A:1-79

Lineage for d1zkea1 (1zke A:1-79)

Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds)
Fold a.30: ROP-like [47379] (8 superfamilies)
4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist
Superfamily a.30.6: HP1531-like [140496] (1 family)
contains short extra helix in the loop between the two bundle-forming helices
automatically mapped to Pfam PF10398
Family a.30.6.1: HP1531-like [140497] (1 protein)
Small sequence family, specific to Helicobacteraceae
Protein Hypothetical protein HP1531 [140498] (1 species)
Species Helicobacter pylori [TaxId:210] [140499] (1 PDB entry)
Uniprot P64665 1-79
Domain d1zkea1: 1zke A:1-79 [125186]
Other proteins in same PDB: d1zkea2, d1zkeb3, d1zkeb4, d1zkec3, d1zked3, d1zked4, d1zkee3, d1zkee4, d1zkef3, d1zkef4
complexed with mg

Details for d1zkea1

PDB Entry: 1zke (more details), 1.6 Å

PDB Description: 1.6 A Crystal Structure of a Protein HP1531 of Unknown Function from Helicobacter pylori

PDB Compounds: (A:) Hypothetical protein HP1531

SCOPe Domain Sequences for d1zkea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zkea1 a.30.6.1 (A:1-79) Hypothetical protein HP1531 {Helicobacter pylori [TaxId: 210]}
mfekirkiladiedsqneiemllklanlslgdfieikrgsmdmpkgvneafftqlseeve
rlkelinalnkikkgllvf

SCOPe Domain Coordinates for d1zkea1:

Click to download the PDB-style file with coordinates for d1zkea1.
(The format of our PDB-style files is described here.)

Timeline for d1zkea1: