PDB entry 1zke

View 1zke on RCSB PDB site
Description: 1.6 A Crystal Structure of a Protein HP1531 of Unknown Function from Helicobacter pylori
Class: structural genomics, unknown function
Keywords: Helicobacter pylori, layer of helix-turn-helix, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2005-05-02, released 2005-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.2
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein HP1531
    Species: HELICOBACTER PYLORI [TaxId:85962]
    Gene: GI:15646139
    Database cross-references and differences (RAF-indexed):
    • Uniprot P64665 (2-80)
      • cloning artifact (81-82)
    Domains in SCOPe 2.07: d1zkea1, d1zkea2
  • Chain 'B':
    Compound: Hypothetical protein HP1531
    Species: HELICOBACTER PYLORI [TaxId:85962]
    Gene: GI:15646139
    Database cross-references and differences (RAF-indexed):
    • Uniprot P64665 (2-80)
      • cloning artifact (1)
      • cloning artifact (81-82)
    Domains in SCOPe 2.07: d1zkeb2, d1zkeb3, d1zkeb4
  • Chain 'C':
    Compound: Hypothetical protein HP1531
    Species: HELICOBACTER PYLORI [TaxId:85962]
    Gene: GI:15646139
    Database cross-references and differences (RAF-indexed):
    • Uniprot P64665 (2-80)
      • cloning artifact (81-82)
    Domains in SCOPe 2.07: d1zkec2, d1zkec3
  • Chain 'D':
    Compound: Hypothetical protein HP1531
    Species: HELICOBACTER PYLORI [TaxId:85962]
    Gene: GI:15646139
    Database cross-references and differences (RAF-indexed):
    • Uniprot P64665 (2-80)
      • cloning artifact (0-1)
      • cloning artifact (81-82)
    Domains in SCOPe 2.07: d1zked2, d1zked3, d1zked4
  • Chain 'E':
    Compound: Hypothetical protein HP1531
    Species: HELICOBACTER PYLORI [TaxId:85962]
    Gene: GI:15646139
    Database cross-references and differences (RAF-indexed):
    • Uniprot P64665 (2-80)
      • cloning artifact (1)
      • cloning artifact (81-82)
    Domains in SCOPe 2.07: d1zkee2, d1zkee3, d1zkee4
  • Chain 'F':
    Compound: Hypothetical protein HP1531
    Species: HELICOBACTER PYLORI [TaxId:85962]
    Gene: GI:15646139
    Database cross-references and differences (RAF-indexed):
    • Uniprot P64665 (2-80)
      • cloning artifact (0-1)
      • cloning artifact (81-82)
    Domains in SCOPe 2.07: d1zkef2, d1zkef3, d1zkef4
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zkeA (A:)
    ghmfekirkiladiedsqneiemllklanlslgdfieikrgsmdmpkgvneafftqlsee
    verlkelinalnkikkgllvfgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zkeA (A:)
    mfekirkiladiedsqneiemllklanlslgdfieikrgsmdmpkgvneafftqlseeve
    rlkelinalnkikkgllvfgs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zkeB (B:)
    ghmfekirkiladiedsqneiemllklanlslgdfieikrgsmdmpkgvneafftqlsee
    verlkelinalnkikkgllvfgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zkeB (B:)
    hmfekirkiladiedsqneiemllklanlslgdfieikrgsmdmpkgvneafftqlseev
    erlkelinalnkikkgllvfgs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1zkeC (C:)
    ghmfekirkiladiedsqneiemllklanlslgdfieikrgsmdmpkgvneafftqlsee
    verlkelinalnkikkgllvfgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zkeC (C:)
    mfekirkiladiedsqneiemllklanlslgdfieikrgsmdmpkgvneafftqlseeve
    rlkelinalnkikkgllvfgs
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zkeD (D:)
    ghmfekirkiladiedsqneiemllklanlslgdfieikrgsmdmpkgvneafftqlsee
    verlkelinalnkikkgllvfgs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1zkeE (E:)
    ghmfekirkiladiedsqneiemllklanlslgdfieikrgsmdmpkgvneafftqlsee
    verlkelinalnkikkgllvfgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zkeE (E:)
    hmfekirkiladiedsqneiemllklanlslgdfieikrgsmdmpkgvneafftqlseev
    erlkelinalnkikkgllvfgs
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zkeF (F:)
    ghmfekirkiladiedsqneiemllklanlslgdfieikrgsmdmpkgvneafftqlsee
    verlkelinalnkikkgllvfgs