Lineage for d1zked2 (1zke D:1-79)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993437Fold a.30: ROP-like [47379] (8 superfamilies)
    4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist
  4. 1993524Superfamily a.30.6: HP1531-like [140496] (1 family) (S)
    contains short extra helix in the loop between the two bundle-forming helices
    automatically mapped to Pfam PF10398
  5. 1993525Family a.30.6.1: HP1531-like [140497] (1 protein)
    Small sequence family, specific to Helicobacteraceae
  6. 1993526Protein Hypothetical protein HP1531 [140498] (1 species)
  7. 1993527Species Helicobacter pylori [TaxId:210] [140499] (1 PDB entry)
    Uniprot P64665 1-79
  8. 1993531Domain d1zked2: 1zke D:1-79 [125189]
    Other proteins in same PDB: d1zkea2, d1zkeb3, d1zkeb4, d1zkec3, d1zked3, d1zked4, d1zkee3, d1zkee4, d1zkef3, d1zkef4
    automated match to d1zkea1
    complexed with mg

Details for d1zked2

PDB Entry: 1zke (more details), 1.6 Å

PDB Description: 1.6 A Crystal Structure of a Protein HP1531 of Unknown Function from Helicobacter pylori
PDB Compounds: (D:) Hypothetical protein HP1531

SCOPe Domain Sequences for d1zked2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zked2 a.30.6.1 (D:1-79) Hypothetical protein HP1531 {Helicobacter pylori [TaxId: 210]}
mfekirkiladiedsqneiemllklanlslgdfieikrgsmdmpkgvneafftqlseeve
rlkelinalnkikkgllvf

SCOPe Domain Coordinates for d1zked2:

Click to download the PDB-style file with coordinates for d1zked2.
(The format of our PDB-style files is described here.)

Timeline for d1zked2: