![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.30: ROP-like [47379] (8 superfamilies) 4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist |
![]() | Superfamily a.30.6: HP1531-like [140496] (1 family) ![]() contains short extra helix in the loop between the two bundle-forming helices automatically mapped to Pfam PF10398 |
![]() | Family a.30.6.1: HP1531-like [140497] (1 protein) Small sequence family, specific to Helicobacteraceae |
![]() | Protein Hypothetical protein HP1531 [140498] (1 species) |
![]() | Species Helicobacter pylori [TaxId:210] [140499] (1 PDB entry) Uniprot P64665 1-79 |
![]() | Domain d1zkef2: 1zke F:1-79 [125191] Other proteins in same PDB: d1zkea2, d1zkeb3, d1zkeb4, d1zkec3, d1zked3, d1zked4, d1zkee3, d1zkee4, d1zkef3, d1zkef4 automated match to d1zkea1 complexed with mg |
PDB Entry: 1zke (more details), 1.6 Å
SCOPe Domain Sequences for d1zkef2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zkef2 a.30.6.1 (F:1-79) Hypothetical protein HP1531 {Helicobacter pylori [TaxId: 210]} mfekirkiladiedsqneiemllklanlslgdfieikrgsmdmpkgvneafftqlseeve rlkelinalnkikkgllvf
Timeline for d1zkef2: