![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
![]() | Protein Class mu GST [81359] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [52867] (17 PDB entries) Uniprot P09488 ! Uniprot P28161 |
![]() | Domain d1xw6a2: 1xw6 A:1-84 [116104] Other proteins in same PDB: d1xw6a1, d1xw6b1, d1xw6c1, d1xw6d1 complexed with gsh |
PDB Entry: 1xw6 (more details), 1.9 Å
SCOPe Domain Sequences for d1xw6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xw6a2 c.47.1.5 (A:1-84) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} pmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp ylidgahkitqsnailcyiarkhn
Timeline for d1xw6a2: