Lineage for d1xsra_ (1xsr A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2814471Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2814942Family b.82.1.14: Ureidoglycolate hydrolase AllA [117312] (1 protein)
    Pfam PF04115; beta-hairpin-swapped dimeric protein of the germin-like fold
  6. 2814943Protein Ureidoglycolate hydrolase AllA [117313] (4 species)
  7. 2814951Species Shigella flexneri [TaxId:623] [117314] (2 PDB entries)
    Uniprot P77731 ! Uniprot P63487
  8. 2814954Domain d1xsra_: 1xsr A: [116001]

Details for d1xsra_

PDB Entry: 1xsr (more details), 2.8 Å

PDB Description: X-Ray structure of Northeast Structural Genomics Consortium target SfR7
PDB Compounds: (A:) Ureidoglycolate hydrolase

SCOPe Domain Sequences for d1xsra_:

Sequence, based on SEQRES records: (download)

>d1xsra_ b.82.1.14 (A:) Ureidoglycolate hydrolase AllA {Shigella flexneri [TaxId: 623]}
mklqvlplsqeafsaygdvietqqrdffhinnglveryhdlalveileqdrtlisinraq
panlpltihelerhplgtqafipmkgevfvvvvalgddkpdlstlrafitngeqgvnyhr
nvwhhplfawqrvtdfltidrggsdncdvesipeqelcfa

Sequence, based on observed residues (ATOM records): (download)

>d1xsra_ b.82.1.14 (A:) Ureidoglycolate hydrolase AllA {Shigella flexneri [TaxId: 623]}
mklqvlplsqeafsaygdvietqqrdffhinnglveryhdlalveileqdrtlisinraq
panlpltihelerhplgtqafipmkgevfvvvvalgddkpdlstlrafitngeqgvnyhr
nvwhhplfawqrvtdfltidrggscdvesipeqelcfa

SCOPe Domain Coordinates for d1xsra_:

Click to download the PDB-style file with coordinates for d1xsra_.
(The format of our PDB-style files is described here.)

Timeline for d1xsra_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xsrb_