![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.1: RmlC-like cupins [51182] (25 families) ![]() |
![]() | Family b.82.1.14: Ureidoglycolate hydrolase AllA [117312] (1 protein) Pfam PF04115; beta-hairpin-swapped dimeric protein of the germin-like fold |
![]() | Protein Ureidoglycolate hydrolase AllA [117313] (4 species) |
![]() | Species Shigella flexneri [TaxId:623] [117314] (2 PDB entries) Uniprot P77731 ! Uniprot P63487 |
![]() | Domain d1xsra_: 1xsr A: [116001] |
PDB Entry: 1xsr (more details), 2.8 Å
SCOPe Domain Sequences for d1xsra_:
Sequence, based on SEQRES records: (download)
>d1xsra_ b.82.1.14 (A:) Ureidoglycolate hydrolase AllA {Shigella flexneri [TaxId: 623]} mklqvlplsqeafsaygdvietqqrdffhinnglveryhdlalveileqdrtlisinraq panlpltihelerhplgtqafipmkgevfvvvvalgddkpdlstlrafitngeqgvnyhr nvwhhplfawqrvtdfltidrggsdncdvesipeqelcfa
>d1xsra_ b.82.1.14 (A:) Ureidoglycolate hydrolase AllA {Shigella flexneri [TaxId: 623]} mklqvlplsqeafsaygdvietqqrdffhinnglveryhdlalveileqdrtlisinraq panlpltihelerhplgtqafipmkgevfvvvvalgddkpdlstlrafitngeqgvnyhr nvwhhplfawqrvtdfltidrggscdvesipeqelcfa
Timeline for d1xsra_: