SCOP 1.71: Domain d1xsra_: 1xsr A:

Lineage for d1xsra_ (1xsr A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (16 families)

5. Family b.82.1.14: Ureidoglycolate hydrolase AllA [117312] (1 protein)
   Pfam 04115; beta-hairpin-swapped dimeric protein of the germin-like fold

6. Protein Ureidoglycolate hydrolase AllA [117313] (1 species)

7. Species Shigella flexneri [TaxId:623] [117314] (2 PDB entries)

8. Domain d1xsra_: 1xsr A: [116001]

Details for d1xsra_

PDB Entry: 1xsr, 2.8 Å

PDB Description: X-Ray structure of Northeast Structural Genomics Consortium target SfR7

SCOP Domain Sequences for d1xsra_:

Sequence, based on SEQRES records:

>d1xsra_ b.82.1.14 (A:) Ureidoglycolate hydrolase AllA {Shigella flexneri}
mklqvlplsqeafsaygdvietqqrdffhinnglveryhdlalveileqdrtlisinraq
panlpltihelerhplgtqafipmkgevfvvvvalgddkpdlstlrafitngeqgvnyhr
nvwhhplfawqrvtdfltidrggsdncdvesipeqelcfa

Sequence, based on observed residues (ATOM records):

>d1xsra_ b.82.1.14 (A:) Ureidoglycolate hydrolase AllA {Shigella flexneri}
mklqvlplsqeafsaygdvietqqrdffhinnglveryhdlalveileqdrtlisinraq
panlpltihelerhplgtqafipmkgevfvvvvalgddkpdlstlrafitngeqgvnyhr
nvwhhplfawqrvtdfltidrggscdvesipeqelcfa

Timeline for d1xsra_:

• d1xsra_ is new in SCOP 1.71
  
• d1xsra_ appears in SCOP 1.73
  
• d1xsra_ appears in the current release, SCOPe 2.08