SCOPe 2.08: Domain d1xsrb_: 1xsr B:

Lineage for d1xsrb_ (1xsr B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.14: Ureidoglycolate hydrolase AllA [117312] (1 protein)
   Pfam PF04115; beta-hairpin-swapped dimeric protein of the germin-like fold

6. Protein Ureidoglycolate hydrolase AllA [117313] (4 species)

7. Species Shigella flexneri [TaxId:623] [117314] (2 PDB entries)
   Uniprot P77731 ! Uniprot P63487

8. Domain d1xsrb_: 1xsr B: [116002]

Details for d1xsrb_

PDB Entry: 1xsr, 2.8 Å

PDB Description: X-Ray structure of Northeast Structural Genomics Consortium target SfR7

PDB Compounds: (B:) Ureidoglycolate hydrolase

SCOPe Domain Sequences for d1xsrb_:

Sequence, based on SEQRES records:

>d1xsrb_ b.82.1.14 (B:) Ureidoglycolate hydrolase AllA {Shigella flexneri [TaxId: 623]}
mklqvlplsqeafsaygdvietqqrdffhinnglveryhdlalveileqdrtlisinraq
panlpltihelerhplgtqafipmkgevfvvvvalgddkpdlstlrafitngeqgvnyhr
nvwhhplfawqrvtdfltidrggsdncdvesipeqelcfa

Sequence, based on observed residues (ATOM records):

>d1xsrb_ b.82.1.14 (B:) Ureidoglycolate hydrolase AllA {Shigella flexneri [TaxId: 623]}
mklqvlplsqeafsaygdvietqqrdffhinnglveryhdlalveileqdrtlisinraq
panlpltihelerhplgtqafipmkgevfvvvvalgddkpdlstlrafitngeqgvnyhr
nvwhhplfawqrvtdfltidrggscdvesipeqelcfa

Timeline for d1xsrb_:

• d1xsrb_ first appeared in SCOP 1.71
  
• d1xsrb_ appears in SCOPe 2.07