PDB entry 1xsr

View 1xsr on RCSB PDB site
Description: X-Ray structure of Northeast Structural Genomics Consortium target SfR7
Class: hydrolase
Keywords: Northeast Structural Genomics Consortium, NESG, Structural Genomics, Protein Structure Initiative, PSI, X-Ray, SfR7, HYDROLASE
Deposited on 2004-10-19, released 2004-10-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.223
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ureidoglycolate hydrolase
    Species: Shigella flexneri [TaxId:623]
    Gene: allA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63487 (0-159)
      • modified residue (0)
      • modified residue (83)
    Domains in SCOPe 2.08: d1xsra_
  • Chain 'B':
    Compound: Ureidoglycolate hydrolase
    Species: Shigella flexneri [TaxId:623]
    Gene: allA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63487 (0-159)
      • modified residue (0)
      • modified residue (83)
    Domains in SCOPe 2.08: d1xsrb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xsrA (A:)
    mklqvlplsqeafsaygdvietqqrdffhinnglveryhdlalveileqdrtlisinraq
    panlpltihelerhplgtqafipmkgevfvvvvalgddkpdlstlrafitngeqgvnyhr
    nvwhhplfawqrvtdfltidrggsdncdvesipeqelcfalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xsrA (A:)
    mklqvlplsqeafsaygdvietqqrdffhinnglveryhdlalveileqdrtlisinraq
    panlpltihelerhplgtqafipmkgevfvvvvalgddkpdlstlrafitngeqgvnyhr
    nvwhhplfawqrvtdfltidrggscdvesipeqelcfa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xsrB (B:)
    mklqvlplsqeafsaygdvietqqrdffhinnglveryhdlalveileqdrtlisinraq
    panlpltihelerhplgtqafipmkgevfvvvvalgddkpdlstlrafitngeqgvnyhr
    nvwhhplfawqrvtdfltidrggsdncdvesipeqelcfalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xsrB (B:)
    mklqvlplsqeafsaygdvietqqrdffhinnglveryhdlalveileqdrtlisinraq
    panlpltihelerhplgtqafipmkgevfvvvvalgddkpdlstlrafitngeqgvnyhr
    nvwhhplfawqrvtdfltidrggscdvesipeqelcfa