![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
![]() | Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) ![]() "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
![]() | Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins) |
![]() | Protein Viral RNA polymerase [56695] (17 species) |
![]() | Species Human rhinovirus 14, HRV-14 [TaxId:12131] [111301] (2 PDB entries) Uniprot P03303 1720-2179 |
![]() | Domain d1xr5a_: 1xr5 A: [115864] complexed with sm missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 1xr5 (more details), 2.8 Å
SCOPe Domain Sequences for d1xr5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xr5a_ e.8.1.4 (A:) Viral RNA polymerase {Human rhinovirus 14, HRV-14 [TaxId: 12131]} gqviarhkvrefninpvntptksklhpsvfydvfpgdkepavlsdndprlevklteslfs kykgnvnteptenmlvavdhyagqllsldiptseltlkealygvdglepidittsagfpy vslgikkrdilnketqdtekmkfyldkygidlplvtyikdelrsvdkvrlgksrlieass lndsvnmrmklgnlykafhqnpgvltgsavgcdpdvfwsvipclmdghlmafdysnfdas lspvwfvclekvltklgfagssliqsicnthhifrdeiyvveggmpsgcsgtsifnsmin niiirtlildaykgidldklkilaygddlivsypyeldpqvlatlgknygltitppdkse tftkmtwenltflkryfkpdqqfpflvhpvmpmkdihesirwtkdpkntqdhvrslcmla whsgekeynefiqkirttdigkclilpeysvlrrrwldlf
Timeline for d1xr5a_: