PDB entry 1xr5

View 1xr5 on RCSB PDB site
Description: Crystal Structure of the RNA-dependent RNA Polymerase 3D from human rhinovirus serotype 14
Class: transferase
Keywords: RNA-Dependent RNA Polymerase, TRANSFERASE
Deposited on 2004-10-13, released 2004-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.267
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Genome polyprotein
    Species: Human rhinovirus 14 [TaxId:12131]
    Gene: P3D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xr5a_
  • Heterogens: SM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xr5A (A:)
    gqviarhkvrefninpvntptksklhpsvfydvfpgdkepavlsdndprlevklteslfs
    kykgnvnteptenmlvavdhyagqllsldiptseltlkealygvdglepidittsagfpy
    vslgikkrdilnketqdtekmkfyldkygidlplvtyikdelrsvdkvrlgksrlieass
    lndsvnmrmklgnlykafhqnpgvltgsavgcdpdvfwsvipclmdghlmafdysnfdas
    lspvwfvclekvltklgfagssliqsicnthhifrdeiyvveggmpsgcsgtsifnsmin
    niiirtlildaykgidldklkilaygddlivsypyeldpqvlatlgknygltitppdkse
    tftkmtwenltflkryfkpdqqfpflvhpvmpmkdihesirwtkdpkntqdhvrslcmla
    whsgekeynefiqkirttdigkclilpeysvlrrrwldlfhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xr5A (A:)
    gqviarhkvrefninpvntptksklhpsvfydvfpgdkepavlsdndprlevklteslfs
    kykgnvnteptenmlvavdhyagqllsldiptseltlkealygvdglepidittsagfpy
    vslgikkrdilnketqdtekmkfyldkygidlplvtyikdelrsvdkvrlgksrlieass
    lndsvnmrmklgnlykafhqnpgvltgsavgcdpdvfwsvipclmdghlmafdysnfdas
    lspvwfvclekvltklgfagssliqsicnthhifrdeiyvveggmpsgcsgtsifnsmin
    niiirtlildaykgidldklkilaygddlivsypyeldpqvlatlgknygltitppdkse
    tftkmtwenltflkryfkpdqqfpflvhpvmpmkdihesirwtkdpkntqdhvrslcmla
    whsgekeynefiqkirttdigkclilpeysvlrrrwldlf