Lineage for d1xr5a_ (1xr5 A:)

  1. Root: SCOP 1.71
  2. 617324Class e: Multi-domain proteins (alpha and beta) [56572] (48 folds)
  3. 618192Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 618193Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 618525Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (2 proteins)
  6. 618533Protein Viral RNA polymerase [56695] (9 species)
  7. 618563Species Human rhinovirus 14, HRV-14 [TaxId:12131] [111301] (1 PDB entry)
  8. 618564Domain d1xr5a_: 1xr5 A: [115864]
    complexed with sm

Details for d1xr5a_

PDB Entry: 1xr5 (more details), 2.8 Å

PDB Description: Crystal Structure of the RNA-dependent RNA Polymerase 3D from human rhinovirus serotype 14

SCOP Domain Sequences for d1xr5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xr5a_ e.8.1.4 (A:) Viral RNA polymerase {Human rhinovirus 14, HRV-14}
gqviarhkvrefninpvntptksklhpsvfydvfpgdkepavlsdndprlevklteslfs
kykgnvnteptenmlvavdhyagqllsldiptseltlkealygvdglepidittsagfpy
vslgikkrdilnketqdtekmkfyldkygidlplvtyikdelrsvdkvrlgksrlieass
lndsvnmrmklgnlykafhqnpgvltgsavgcdpdvfwsvipclmdghlmafdysnfdas
lspvwfvclekvltklgfagssliqsicnthhifrdeiyvveggmpsgcsgtsifnsmin
niiirtlildaykgidldklkilaygddlivsypyeldpqvlatlgknygltitppdkse
tftkmtwenltflkryfkpdqqfpflvhpvmpmkdihesirwtkdpkntqdhvrslcmla
whsgekeynefiqkirttdigkclilpeysvlrrrwldlf

SCOP Domain Coordinates for d1xr5a_:

Click to download the PDB-style file with coordinates for d1xr5a_.
(The format of our PDB-style files is described here.)

Timeline for d1xr5a_: