Class e: Multi-domain proteins (alpha and beta) [56572] (48 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (2 proteins) |
Protein Viral RNA polymerase [56695] (9 species) |
Species Human rhinovirus 14, HRV-14 [TaxId:12131] [111301] (1 PDB entry) |
Domain d1xr5a_: 1xr5 A: [115864] complexed with sm |
PDB Entry: 1xr5 (more details), 2.8 Å
SCOP Domain Sequences for d1xr5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xr5a_ e.8.1.4 (A:) Viral RNA polymerase {Human rhinovirus 14, HRV-14} gqviarhkvrefninpvntptksklhpsvfydvfpgdkepavlsdndprlevklteslfs kykgnvnteptenmlvavdhyagqllsldiptseltlkealygvdglepidittsagfpy vslgikkrdilnketqdtekmkfyldkygidlplvtyikdelrsvdkvrlgksrlieass lndsvnmrmklgnlykafhqnpgvltgsavgcdpdvfwsvipclmdghlmafdysnfdas lspvwfvclekvltklgfagssliqsicnthhifrdeiyvveggmpsgcsgtsifnsmin niiirtlildaykgidldklkilaygddlivsypyeldpqvlatlgknygltitppdkse tftkmtwenltflkryfkpdqqfpflvhpvmpmkdihesirwtkdpkntqdhvrslcmla whsgekeynefiqkirttdigkclilpeysvlrrrwldlf
Timeline for d1xr5a_: