Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (68 proteins) |
Protein Negative elongation factor E, NELF-E [143302] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [143303] (3 PDB entries) Uniprot P18615 257-335! Uniprot P18615 258-341 |
Domain d1x5pa1: 1x5p A:8-91 [121716] |
PDB Entry: 1x5p (more details)
SCOPe Domain Sequences for d1x5pa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x5pa1 d.58.7.1 (A:8-91) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} erraprkgntlyvygedmtptllrgafspfgniidlsmdpprncafvtyekmesadqava elngtqvesvqlkvniarkqpmld
Timeline for d1x5pa1: