PDB entry 1x5p

View 1x5p on RCSB PDB site
Description: Solution structure of RRM domain in Parp14
Class: RNA binding protein
Keywords: NMR, structure genomics, RRM domain, Parp14, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2005-05-16, released 2005-11-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: negative elongation factor e
    Species: Homo sapiens [TaxId:9606]
    Gene: RDBP, NELFE, RD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18615 (7-90)
      • cloning artifact (0-6)
      • cloning artifact (91-96)
    Domains in SCOPe 2.04: d1x5pa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x5pA (A:)
    gssgssgerraprkgntlyvygedmtptllrgafspfgniidlsmdpprncafvtyekme
    sadqavaelngtqvesvqlkvniarkqpmldsgpssg