Lineage for d1x5pa1 (1x5p A:8-91)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2951973Protein Negative elongation factor E, NELF-E [143302] (1 species)
  7. 2951974Species Human (Homo sapiens) [TaxId:9606] [143303] (3 PDB entries)
    Uniprot P18615 257-335! Uniprot P18615 258-341
  8. 2951977Domain d1x5pa1: 1x5p A:8-91 [121716]
    Other proteins in same PDB: d1x5pa2, d1x5pa3

Details for d1x5pa1

PDB Entry: 1x5p (more details)

PDB Description: solution structure of rrm domain in parp14
PDB Compounds: (A:) negative elongation factor e

SCOPe Domain Sequences for d1x5pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x5pa1 d.58.7.1 (A:8-91) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]}
erraprkgntlyvygedmtptllrgafspfgniidlsmdpprncafvtyekmesadqava
elngtqvesvqlkvniarkqpmld

SCOPe Domain Coordinates for d1x5pa1:

Click to download the PDB-style file with coordinates for d1x5pa1.
(The format of our PDB-style files is described here.)

Timeline for d1x5pa1: