Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.1: Translational machinery components [54212] (5 proteins) |
Protein Elongation factor G (EF-G), domain IV [54213] (2 species) |
Species Thermus thermophilus, EF-G-2 [TaxId:274] [142925] (2 PDB entries) Uniprot Q5SI76 448-562 TTHA1498 |
Domain d1wdta3: 1wdt A:455-569 [120913] Other proteins in same PDB: d1wdta1, d1wdta2, d1wdta4, d1wdta5, d1wdta6 complexed with gtp, mg |
PDB Entry: 1wdt (more details), 2.2 Å
SCOPe Domain Sequences for d1wdta3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wdta3 d.14.1.1 (A:455-569) Elongation factor G (EF-G), domain IV {Thermus thermophilus, EF-G-2 [TaxId: 274]} pyretikkvaegqgkykkqtgghgqygdvwlrlepaseygfewritggvipskyqeaiee gikeaakkgvlagfpvmgfkaivyngsyhevdssdlafqiaaslafkkvmaeahp
Timeline for d1wdta3: