Lineage for d1wdta3 (1wdt A:455-569)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930061Family d.14.1.1: Translational machinery components [54212] (5 proteins)
  6. 2930091Protein Elongation factor G (EF-G), domain IV [54213] (2 species)
  7. 2930103Species Thermus thermophilus, EF-G-2 [TaxId:274] [142925] (2 PDB entries)
    Uniprot Q5SI76 448-562
    TTHA1498
  8. 2930105Domain d1wdta3: 1wdt A:455-569 [120913]
    Other proteins in same PDB: d1wdta1, d1wdta2, d1wdta4, d1wdta5, d1wdta6
    complexed with gtp, mg

Details for d1wdta3

PDB Entry: 1wdt (more details), 2.2 Å

PDB Description: Crystal structure of ttk003000868 from Thermus thermophilus HB8
PDB Compounds: (A:) elongation factor G homolog

SCOPe Domain Sequences for d1wdta3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wdta3 d.14.1.1 (A:455-569) Elongation factor G (EF-G), domain IV {Thermus thermophilus, EF-G-2 [TaxId: 274]}
pyretikkvaegqgkykkqtgghgqygdvwlrlepaseygfewritggvipskyqeaiee
gikeaakkgvlagfpvmgfkaivyngsyhevdssdlafqiaaslafkkvmaeahp

SCOPe Domain Coordinates for d1wdta3:

Click to download the PDB-style file with coordinates for d1wdta3.
(The format of our PDB-style files is described here.)

Timeline for d1wdta3: