Lineage for d1wdta5 (1wdt A:378-454)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953474Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) (S)
  5. 2953475Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (5 proteins)
    domain III structure is lacking some of the superfamily characters and is often disordered in crystals
  6. 2953534Protein Elongation factor G (EF-G) [54982] (2 species)
    domain III is seen in 1FNM but disordered in the most of other PDB entries
  7. 2953550Species Thermus thermophilus, EF-G-2 [TaxId:274] [143371] (2 PDB entries)
    Uniprot Q5SI76 371-447! Uniprot Q5SI76 563-658
    TTHA1498
  8. 2953554Domain d1wdta5: 1wdt A:378-454 [120915]
    Other proteins in same PDB: d1wdta1, d1wdta2, d1wdta3, d1wdta6
    complexed with gtp, mg

Details for d1wdta5

PDB Entry: 1wdt (more details), 2.2 Å

PDB Description: Crystal structure of ttk003000868 from Thermus thermophilus HB8
PDB Compounds: (A:) elongation factor G homolog

SCOPe Domain Sequences for d1wdta5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wdta5 d.58.11.1 (A:378-454) Elongation factor G (EF-G) {Thermus thermophilus, EF-G-2 [TaxId: 274]}
lpdpnvpvalhpkgrtdearlgealrklleedpslklerqeetgelllwghgelhlatak
erlqdygvevefsvpkv

SCOPe Domain Coordinates for d1wdta5:

Click to download the PDB-style file with coordinates for d1wdta5.
(The format of our PDB-style files is described here.)

Timeline for d1wdta5: