PDB entry 1wdt

View 1wdt on RCSB PDB site
Description: Crystal structure of ttk003000868 from Thermus thermophilus HB8
Class: structural genomics, unknown function
Keywords: GTP Complex, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2004-05-17, released 2005-05-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.197
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wdtA (A:)
    mgteggamirtvalvghagsgkttlteallyktgakerrgrveegttttdytpeaklhrt
    tvrtgvapllfrghrvflldapgygdfvgeirgaleaadaalvavsaeagvqvgterawt
    vaerlglprmvvvtkldkggdyyalledlrstlgpilpidlplyeggkwvglidvfhgka
    yryengeereaevppeerervqrfrqevleaivetdegllekylegeevtgealekafhe
    avrrgllypvalasgereigvlpllelilealpspterfgdgpplakvfkvqvdpfmgqv
    aylrlyrgrlkpgdslqseagqvrlphlyvpmgkdlleveeaeagfvlgvpkaeglhrgm
    vlwqgekpeseevpfarlpdpnvpvalhpkgrtdearlgealrklleedpslklerqeet
    gelllwghgelhlatakerlqdygvevefsvpkvpyretikkvaegqgkykkqtgghgqy
    gdvwlrlepaseygfewritggvipskyqeaieegikeaakkgvlagfpvmgfkaivyng
    syhevdssdlafqiaaslafkkvmaeahpvllepiyrlkvlapqervgdvlsdlqarrgr
    ilgmeqegalsvvhaevplaevleyykalpgltggagaytlefshyaevpphlaqrivqe
    raqeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wdtA (A:)
    gamirtvalvghagsgkttlteallyktgakerrgrveegttttdytpeaklhrttvrtg
    vapllfrghrvflldapgygdfvgeirgaleaadaalvavsaeagvqvgterawtvaerl
    glprmvvvtkldkggdyyalledlrstlgpilpidlplyeggkwvglidvfhgkayryen
    geereaevppeerervqrfrqevleaivetdegllekylegeevtgealekafheavrrg
    llypvalasgereigvlpllelilealpspterfgdgpplakvfkvqvdpfmgqvaylrl
    yrgrlkpgdslqseagqvrlphlyvpmgkdlleveeaeagfvlgvpkaeglhrgmvlwqg
    ekpeseevpfarlpdpnvpvalhpkgrtdearlgealrklleedpslklerqeetgelll
    wghgelhlatakerlqdygvevefsvpkvpyretikkvaegqgkykkqtgghgqygdvwl
    rlepaseygfewritggvipskyqeaieegikeaakkgvlagfpvmgfkaivyngsyhev
    dssdlafqiaaslafkkvmaeahpvllepiyrlkvlapqervgdvlsdlqarrgrilgme
    qegalsvvhaevplaevleyykalpgltggagaytlefshyaevpphlaqrivqeraqeg