Lineage for d1wdta1 (1wdt A:275-377)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2792984Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2792985Family b.43.3.1: Elongation factors [50448] (11 proteins)
  6. 2793028Protein Elongation factor G (EF-G), domain II [50456] (2 species)
  7. 2793040Species Thermus thermophilus, EF-G-2 [TaxId:274] [141334] (2 PDB entries)
    Uniprot Q5SI76 268-370
    TTHA1498
  8. 2793042Domain d1wdta1: 1wdt A:275-377 [120911]
    Other proteins in same PDB: d1wdta2, d1wdta3, d1wdta4, d1wdta5, d1wdta6
    complexed with gtp, mg

Details for d1wdta1

PDB Entry: 1wdt (more details), 2.2 Å

PDB Description: Crystal structure of ttk003000868 from Thermus thermophilus HB8
PDB Compounds: (A:) elongation factor G homolog

SCOPe Domain Sequences for d1wdta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wdta1 b.43.3.1 (A:275-377) Elongation factor G (EF-G), domain II {Thermus thermophilus, EF-G-2 [TaxId: 274]}
pterfgdgpplakvfkvqvdpfmgqvaylrlyrgrlkpgdslqseagqvrlphlyvpmgk
dlleveeaeagfvlgvpkaeglhrgmvlwqgekpeseevpfar

SCOPe Domain Coordinates for d1wdta1:

Click to download the PDB-style file with coordinates for d1wdta1.
(The format of our PDB-style files is described here.)

Timeline for d1wdta1: