![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.3: Translation proteins [50447] (7 families) ![]() |
![]() | Family b.43.3.1: Elongation factors [50448] (11 proteins) |
![]() | Protein Elongation factor G (EF-G), domain II [50456] (2 species) |
![]() | Species Thermus thermophilus, EF-G-2 [TaxId:274] [141334] (2 PDB entries) Uniprot Q5SI76 268-370 TTHA1498 |
![]() | Domain d1wdta1: 1wdt A:275-377 [120911] Other proteins in same PDB: d1wdta2, d1wdta3, d1wdta4, d1wdta5, d1wdta6 complexed with gtp, mg |
PDB Entry: 1wdt (more details), 2.2 Å
SCOPe Domain Sequences for d1wdta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wdta1 b.43.3.1 (A:275-377) Elongation factor G (EF-G), domain II {Thermus thermophilus, EF-G-2 [TaxId: 274]} pterfgdgpplakvfkvqvdpfmgqvaylrlyrgrlkpgdslqseagqvrlphlyvpmgk dlleveeaeagfvlgvpkaeglhrgmvlwqgekpeseevpfar
Timeline for d1wdta1: