SCOPe 2.08: Domain d1uypa2: 1uyp A:1-294

Lineage for d1uypa2 (1uyp A:1-294)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.67: 5-bladed beta-propeller [50933] (4 superfamilies)
consists of five 4-stranded beta-sheet motifs; meander
Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families)
Family b.67.2.3: Glycosyl hydrolases family 32 N-terminal domain [101884] (3 proteins)
Pfam PF00251; Glycosyl hydrolase family 32
Protein Beta-fructosidase (invertase), N-terminal domain [101885] (1 species)
Species Thermotoga maritima [TaxId:2336] [101886] (2 PDB entries)
Domain d1uypa2: 1uyp A:1-294 [100177]
Other proteins in same PDB: d1uypa1, d1uypb1, d1uypc1, d1uypd1, d1uype1, d1uypf1
complexed with cit, gol, na, so4

Details for d1uypa2

PDB Entry: 1uyp (more details), 1.9 Å

PDB Description: the three-dimensional structure of beta-fructosidase (invertase) from thermotoga maritima

PDB Compounds: (A:) beta-fructosidase

SCOPe Domain Sequences for d1uypa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uypa2 b.67.2.3 (A:1-294) Beta-fructosidase (invertase), N-terminal domain {Thermotoga maritima [TaxId: 2336]}
lfkpnyhffpitgwmndpnglifwkgkyhmfyqynprkpewgnicwghavsddlvhwrhl
pvalypddethgvfsgsavekdgkmflvytyyrdpthnkgeketqcvvmsengldfvkyd
gnpviskppeegthafrdpkvnrsngewrmvlgsgkdekigrvllytsddlfhwkyegai
fedettkeiecpdlvrigekdiliysitstnsvlfsmgelkegklnvekrglldhgtdfy
aaqtffgtdrvvvigwlqswlrtglyptkregwngvmslprelyvennelkvkp

SCOPe Domain Coordinates for d1uypa2:

Click to download the PDB-style file with coordinates for d1uypa2.
(The format of our PDB-style files is described here.)

Timeline for d1uypa2: