PDB entry 1uyp

View 1uyp on RCSB PDB site
Description: the three-dimensional structure of beta-fructosidase (invertase) from thermotoga maritima
Class: hydrolase
Keywords: invertase, glycosyl hydrolase family 32, sucrose degradation, beta-propeller, hydrolase
Deposited on 2004-03-02, released 2004-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.179
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-fructosidase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33833 (0-431)
      • conflict (0)
      • conflict (107)
      • conflict (178)
    Domains in SCOPe 2.07: d1uypa1, d1uypa2
  • Chain 'B':
    Compound: beta-fructosidase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33833 (0-431)
      • conflict (0)
      • conflict (107)
      • conflict (178)
    Domains in SCOPe 2.07: d1uypb1, d1uypb2
  • Chain 'C':
    Compound: beta-fructosidase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33833 (0-431)
      • conflict (0)
      • conflict (107)
      • conflict (178)
    Domains in SCOPe 2.07: d1uypc1, d1uypc2
  • Chain 'D':
    Compound: beta-fructosidase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33833 (0-431)
      • conflict (0)
      • conflict (107)
      • conflict (178)
    Domains in SCOPe 2.07: d1uypd1, d1uypd2
  • Chain 'E':
    Compound: beta-fructosidase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33833 (0-431)
      • conflict (0)
      • conflict (107)
      • conflict (178)
    Domains in SCOPe 2.07: d1uype1, d1uype2
  • Chain 'F':
    Compound: beta-fructosidase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33833 (0-431)
      • conflict (0)
      • conflict (107)
      • conflict (178)
    Domains in SCOPe 2.07: d1uypf1, d1uypf2
  • Heterogens: SO4, CIT, GOL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uypA (A:)
    lfkpnyhffpitgwmndpnglifwkgkyhmfyqynprkpewgnicwghavsddlvhwrhl
    pvalypddethgvfsgsavekdgkmflvytyyrdpthnkgeketqcvvmsengldfvkyd
    gnpviskppeegthafrdpkvnrsngewrmvlgsgkdekigrvllytsddlfhwkyegai
    fedettkeiecpdlvrigekdiliysitstnsvlfsmgelkegklnvekrglldhgtdfy
    aaqtffgtdrvvvigwlqswlrtglyptkregwngvmslprelyvennelkvkpvdella
    lrkrkvfetaksgtflldvkensyeivcefsgeielrmgneseevvitksrdelivdttr
    sgvsggevrkstvedeatnrirafldscsvefffndsiafsfrihpenvynilsvksnqv
    klevfeleniwl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uypB (B:)
    lfkpnyhffpitgwmndpnglifwkgkyhmfyqynprkpewgnicwghavsddlvhwrhl
    pvalypddethgvfsgsavekdgkmflvytyyrdpthnkgeketqcvvmsengldfvkyd
    gnpviskppeegthafrdpkvnrsngewrmvlgsgkdekigrvllytsddlfhwkyegai
    fedettkeiecpdlvrigekdiliysitstnsvlfsmgelkegklnvekrglldhgtdfy
    aaqtffgtdrvvvigwlqswlrtglyptkregwngvmslprelyvennelkvkpvdella
    lrkrkvfetaksgtflldvkensyeivcefsgeielrmgneseevvitksrdelivdttr
    sgvsggevrkstvedeatnrirafldscsvefffndsiafsfrihpenvynilsvksnqv
    klevfeleniwl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uypC (C:)
    lfkpnyhffpitgwmndpnglifwkgkyhmfyqynprkpewgnicwghavsddlvhwrhl
    pvalypddethgvfsgsavekdgkmflvytyyrdpthnkgeketqcvvmsengldfvkyd
    gnpviskppeegthafrdpkvnrsngewrmvlgsgkdekigrvllytsddlfhwkyegai
    fedettkeiecpdlvrigekdiliysitstnsvlfsmgelkegklnvekrglldhgtdfy
    aaqtffgtdrvvvigwlqswlrtglyptkregwngvmslprelyvennelkvkpvdella
    lrkrkvfetaksgtflldvkensyeivcefsgeielrmgneseevvitksrdelivdttr
    sgvsggevrkstvedeatnrirafldscsvefffndsiafsfrihpenvynilsvksnqv
    klevfeleniwl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uypD (D:)
    lfkpnyhffpitgwmndpnglifwkgkyhmfyqynprkpewgnicwghavsddlvhwrhl
    pvalypddethgvfsgsavekdgkmflvytyyrdpthnkgeketqcvvmsengldfvkyd
    gnpviskppeegthafrdpkvnrsngewrmvlgsgkdekigrvllytsddlfhwkyegai
    fedettkeiecpdlvrigekdiliysitstnsvlfsmgelkegklnvekrglldhgtdfy
    aaqtffgtdrvvvigwlqswlrtglyptkregwngvmslprelyvennelkvkpvdella
    lrkrkvfetaksgtflldvkensyeivcefsgeielrmgneseevvitksrdelivdttr
    sgvsggevrkstvedeatnrirafldscsvefffndsiafsfrihpenvynilsvksnqv
    klevfeleniwl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uypE (E:)
    lfkpnyhffpitgwmndpnglifwkgkyhmfyqynprkpewgnicwghavsddlvhwrhl
    pvalypddethgvfsgsavekdgkmflvytyyrdpthnkgeketqcvvmsengldfvkyd
    gnpviskppeegthafrdpkvnrsngewrmvlgsgkdekigrvllytsddlfhwkyegai
    fedettkeiecpdlvrigekdiliysitstnsvlfsmgelkegklnvekrglldhgtdfy
    aaqtffgtdrvvvigwlqswlrtglyptkregwngvmslprelyvennelkvkpvdella
    lrkrkvfetaksgtflldvkensyeivcefsgeielrmgneseevvitksrdelivdttr
    sgvsggevrkstvedeatnrirafldscsvefffndsiafsfrihpenvynilsvksnqv
    klevfeleniwl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uypF (F:)
    lfkpnyhffpitgwmndpnglifwkgkyhmfyqynprkpewgnicwghavsddlvhwrhl
    pvalypddethgvfsgsavekdgkmflvytyyrdpthnkgeketqcvvmsengldfvkyd
    gnpviskppeegthafrdpkvnrsngewrmvlgsgkdekigrvllytsddlfhwkyegai
    fedettkeiecpdlvrigekdiliysitstnsvlfsmgelkegklnvekrglldhgtdfy
    aaqtffgtdrvvvigwlqswlrtglyptkregwngvmslprelyvennelkvkpvdella
    lrkrkvfetaksgtflldvkensyeivcefsgeielrmgneseevvitksrdelivdttr
    sgvsggevrkstvedeatnrirafldscsvefffndsiafsfrihpenvynilsvksnqv
    klevfeleniwl