Lineage for d1uypa2 (1uyp A:1-294)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.67: 5-bladed beta-propeller [50933] (4 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) (S)
  5. Family b.67.2.3: Glycosyl hydrolases family 32 N-terminal domain [101884] (3 proteins)
    Pfam PF00251; Glycosyl hydrolase family 32
  6. Protein Beta-fructosidase (invertase), N-terminal domain [101885] (1 species)
  7. Species Thermotoga maritima [TaxId:2336] [101886] (2 PDB entries)
  8. Domain d1uypa2: 1uyp A:1-294 [100177]
    Other proteins in same PDB: d1uypa1, d1uypb1, d1uypc1, d1uypd1, d1uype1, d1uypf1
    complexed with cit, gol, na, so4

Details for d1uypa2

PDB Entry: 1uyp (more details), 1.9 Å

PDB Description: the three-dimensional structure of beta-fructosidase (invertase) from thermotoga maritima
PDB Compounds: (A:) beta-fructosidase

SCOPe Domain Sequences for d1uypa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uypa2 b.67.2.3 (A:1-294) Beta-fructosidase (invertase), N-terminal domain {Thermotoga maritima [TaxId: 2336]}
lfkpnyhffpitgwmndpnglifwkgkyhmfyqynprkpewgnicwghavsddlvhwrhl
pvalypddethgvfsgsavekdgkmflvytyyrdpthnkgeketqcvvmsengldfvkyd
gnpviskppeegthafrdpkvnrsngewrmvlgsgkdekigrvllytsddlfhwkyegai
fedettkeiecpdlvrigekdiliysitstnsvlfsmgelkegklnvekrglldhgtdfy
aaqtffgtdrvvvigwlqswlrtglyptkregwngvmslprelyvennelkvkp

SCOPe Domain Coordinates for d1uypa2 are not available.

Timeline for d1uypa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uypa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1uypb1, d1uypb2, d1uypc1, d1uypc2, d1uypd1, d1uypd2, d1uype1, d1uype2, d1uypf1, d1uypf2