Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.19: Glycosyl hydrolases family 32 C-terminal domain [101652] (2 proteins) Pfam PF08244 flat sheet beta-sandwich lacking the characteristic beta-bulge in the C-terminal strand |
Protein Beta-fructosidase (invertase), C-terminal domain [101653] (1 species) |
Species Thermotoga maritima [TaxId:2336] [101654] (2 PDB entries) |
Domain d1uypf1: 1uyp F:295-432 [100186] Other proteins in same PDB: d1uypa2, d1uypb2, d1uypc2, d1uypd2, d1uype2, d1uypf2 complexed with cit, gol, na, so4 |
PDB Entry: 1uyp (more details), 1.9 Å
SCOPe Domain Sequences for d1uypf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uypf1 b.29.1.19 (F:295-432) Beta-fructosidase (invertase), C-terminal domain {Thermotoga maritima [TaxId: 2336]} vdellalrkrkvfetaksgtflldvkensyeivcefsgeielrmgneseevvitksrdel ivdttrsgvsggevrkstvedeatnrirafldscsvefffndsiafsfrihpenvynils vksnqvklevfeleniwl
Timeline for d1uypf1: