Lineage for d1uypc1 (1uyp C:295-432)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780478Family b.29.1.19: Glycosyl hydrolases family 32 C-terminal domain [101652] (2 proteins)
    Pfam PF08244
    flat sheet beta-sandwich lacking the characteristic beta-bulge in the C-terminal strand
  6. 2780479Protein Beta-fructosidase (invertase), C-terminal domain [101653] (1 species)
  7. 2780480Species Thermotoga maritima [TaxId:2336] [101654] (2 PDB entries)
  8. 2780489Domain d1uypc1: 1uyp C:295-432 [100180]
    Other proteins in same PDB: d1uypa2, d1uypb2, d1uypc2, d1uypd2, d1uype2, d1uypf2
    complexed with cit, gol, na, so4

Details for d1uypc1

PDB Entry: 1uyp (more details), 1.9 Å

PDB Description: the three-dimensional structure of beta-fructosidase (invertase) from thermotoga maritima
PDB Compounds: (C:) beta-fructosidase

SCOPe Domain Sequences for d1uypc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uypc1 b.29.1.19 (C:295-432) Beta-fructosidase (invertase), C-terminal domain {Thermotoga maritima [TaxId: 2336]}
vdellalrkrkvfetaksgtflldvkensyeivcefsgeielrmgneseevvitksrdel
ivdttrsgvsggevrkstvedeatnrirafldscsvefffndsiafsfrihpenvynils
vksnqvklevfeleniwl

SCOPe Domain Coordinates for d1uypc1:

Click to download the PDB-style file with coordinates for d1uypc1.
(The format of our PDB-style files is described here.)

Timeline for d1uypc1: