Lineage for d1uypa2 (1uyp A:1-294)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 379465Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 379471Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (3 families) (S)
  5. 379488Family b.67.2.3: Beta-fructosidase (invertase), N-terminal domain [101884] (1 protein)
    Glycosyl hydrolase family 32
  6. 379489Protein Beta-fructosidase (invertase), N-terminal domain [101885] (1 species)
  7. 379490Species Thermotoga maritima [TaxId:243274] [101886] (1 PDB entry)
  8. 379491Domain d1uypa2: 1uyp A:1-294 [100177]
    Other proteins in same PDB: d1uypa1, d1uypb1, d1uypc1, d1uypd1, d1uype1, d1uypf1

Details for d1uypa2

PDB Entry: 1uyp (more details), 1.9 Å

PDB Description: the three-dimensional structure of beta-fructosidase (invertase) from thermotoga maritima

SCOP Domain Sequences for d1uypa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uypa2 b.67.2.3 (A:1-294) Beta-fructosidase (invertase), N-terminal domain {Thermotoga maritima}
lfkpnyhffpitgwmndpnglifwkgkyhmfyqynprkpewgnicwghavsddlvhwrhl
pvalypddethgvfsgsavekdgkmflvytyyrdpthnkgeketqcvvmsengldfvkyd
gnpviskppeegthafrdpkvnrsngewrmvlgsgkdekigrvllytsddlfhwkyegai
fedettkeiecpdlvrigekdiliysitstnsvlfsmgelkegklnvekrglldhgtdfy
aaqtffgtdrvvvigwlqswlrtglyptkregwngvmslprelyvennelkvkp

SCOP Domain Coordinates for d1uypa2:

Click to download the PDB-style file with coordinates for d1uypa2.
(The format of our PDB-style files is described here.)

Timeline for d1uypa2: