SCOPe 2.07: Domain d1urza1: 1urz A:303-401

Lineage for d1urza1 (1urz A:303-401)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.18: E set domains [81296] (24 families)
"Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)
Protein Envelope glycoprotein [49213] (5 species)
Species Tick-borne encephalitis virus [TaxId:11084] [49214] (2 PDB entries)
Domain d1urza1: 1urz A:303-401 [99838]
Other proteins in same PDB: d1urza2, d1urzb2, d1urzc2, d1urzd2, d1urze2, d1urzf2

Details for d1urza1

PDB Entry: 1urz (more details), 2.7 Å

PDB Description: low ph induced, membrane fusion conformation of the envelope protein of tick-borne encephalitis virus

PDB Compounds: (A:) envelope protein

SCOPe Domain Sequences for d1urza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1urza1 b.1.18.4 (A:303-401) Envelope glycoprotein {Tick-borne encephalitis virus [TaxId: 11084]}
tytmcdktkftwkraptdsghdtvvmevtfsgtkpcripvravahgspdvnvamlitpnp
tienngggfiemqlppgdniiyvgelshqwfqkgssigr

SCOPe Domain Coordinates for d1urza1:

Click to download the PDB-style file with coordinates for d1urza1.
(The format of our PDB-style files is described here.)

Timeline for d1urza1: