![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (18 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (2 proteins) |
![]() | Protein Envelope glycoprotein [49213] (3 species) |
![]() | Species Tick-borne encephalitis virus [TaxId:11084] [49214] (2 PDB entries) |
![]() | Domain d1urza1: 1urz A:303-401 [99838] Other proteins in same PDB: d1urza2, d1urzb2, d1urzc2, d1urzd2, d1urze2, d1urzf2 |
PDB Entry: 1urz (more details), 2.7 Å
SCOP Domain Sequences for d1urza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1urza1 b.1.18.4 (A:303-401) Envelope glycoprotein {Tick-borne encephalitis virus} tytmcdktkftwkraptdsghdtvvmevtfsgtkpcripvravahgspdvnvamlitpnp tienngggfiemqlppgdniiyvgelshqwfqkgssigr
Timeline for d1urza1: