SCOPe 2.07: Domain d1urzc1: 1urz C:303-401

Lineage for d1urzc1 (1urz C:303-401)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)

6. Protein Envelope glycoprotein [49213] (5 species)

7. Species Tick-borne encephalitis virus [TaxId:11084] [49214] (2 PDB entries)

8. Domain d1urzc1: 1urz C:303-401 [99842]
   Other proteins in same PDB: d1urza2, d1urzb2, d1urzc2, d1urzd2, d1urze2, d1urzf2

Details for d1urzc1

PDB Entry: 1urz, 2.7 Å

PDB Description: low ph induced, membrane fusion conformation of the envelope protein of tick-borne encephalitis virus

PDB Compounds: (C:) envelope protein

SCOPe Domain Sequences for d1urzc1:

Sequence; same for both SEQRES and ATOM records:

>d1urzc1 b.1.18.4 (C:303-401) Envelope glycoprotein {Tick-borne encephalitis virus [TaxId: 11084]}
tytmcdktkftwkraptdsghdtvvmevtfsgtkpcripvravahgspdvnvamlitpnp
tienngggfiemqlppgdniiyvgelshqwfqkgssigr

Timeline for d1urzc1:

• d1urzc1 first appeared in SCOP 1.67
  
• d1urzc1 appears in SCOPe 2.06
  
• d1urzc1 appears in the current release, SCOPe 2.08