| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
| Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins) |
| Protein Biotin carboxylase (BC), N-terminal domain [52442] (2 species) subunit of acetyl-CoA and pyruvate carboxylases |
| Species Aquifex aeolicus [TaxId:63363] [102283] (1 PDB entry) |
| Domain d1ulza2: 1ulz A:1-114 [99576] Other proteins in same PDB: d1ulza1, d1ulza3 |
PDB Entry: 1ulz (more details), 2.2 Å
SCOPe Domain Sequences for d1ulza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ulza2 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-terminal domain {Aquifex aeolicus [TaxId: 63363]}
mvnkvlvanrgeiavriirackelgiptvaiynevestarhvkladeaymigtdpldtyl
nkqriinlalevgadaihpgygflaenaefakmceeagitfigphwkvielmgd
Timeline for d1ulza2: