Lineage for d1ulza1 (1ulz A:329-451)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2082731Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2082834Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 2082835Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins)
    probable rudiment form of the biotinyl-carrier domain
  6. 2082842Protein Biotin carboxylase (BC), C-domain [51248] (2 species)
    subunit of acetyl-CoA and pyruvate carboxylases
  7. 2082843Species Aquifex aeolicus [TaxId:63363] [102004] (1 PDB entry)
  8. 2082844Domain d1ulza1: 1ulz A:329-451 [99575]
    Other proteins in same PDB: d1ulza2, d1ulza3

Details for d1ulza1

PDB Entry: 1ulz (more details), 2.2 Å

PDB Description: crystal structure of the biotin carboxylase subunit of pyruvate carboxylase
PDB Compounds: (A:) pyruvate carboxylase n-terminal domain

SCOPe Domain Sequences for d1ulza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ulza1 b.84.2.1 (A:329-451) Biotin carboxylase (BC), C-domain {Aquifex aeolicus [TaxId: 63363]}
fngyaiecrinaedpkknfapstrvieryyvpggfgirvehaaargfevtpyydsmiakl
itwaptwdeavermraaletyeitgvkttipllinimkekdfkagkfttkyleehpevfe
yee

SCOPe Domain Coordinates for d1ulza1:

Click to download the PDB-style file with coordinates for d1ulza1.
(The format of our PDB-style files is described here.)

Timeline for d1ulza1: